Our Exhibitors
Aalberts
Aalberts integrated piping systems develops the most advanced integrated piping systems for distribution and control of liquids and gases. These systems are used in various markets such as industry, utility and residential construction. We offer fully integrated piping systems in valve, connection, fastening and piping technology. In close cooperation with our customers, we build the perfect integrated piping system that meets all their requirements. Our piping systems are easy to specify, install, check and maintain, saving you considerable time on preparation and installation. We meet the highest quality and industry standards required in our markets. Don’t just buy products, buy solutions.
ANPI
For more than 50 years, ANPI provides tests, certifications, inspections on installations and audits of companies in the fields of fire and intrusion prevention. From passive to active protection, ANPI inspects all types of products and installations (labs & on site tests, approvals, commissioning, periodic inspections.) Our inspections are not limited to checking technical compliance of the installation, but also involve the evaluation of other architectural and organizational criteria (product categories, structure and type of structure, type of storage, …). The scope of expertise of our laboratories covers fire, intrusion, equipment for asset protection, electric and electronic equipment. We also take a leading part in drafting regulations and standards on European as well national levels.
ASC Engineered Solutions
Solutions for a stronger, safer, better world. Every day, the professionals who build and maintain our world depend on ASC Engineered Solutions. Our precision-engineered pipe connections, valves, support solutions and related services are used in everything from commercial buildings and industrial facilities to power plants and oil fields.This ability to create value that extends beyond category-leading products is what makes ASC Engineered Solutions a true strategic partner able to drive customer success.Together, the brands of ASC Engineered Solutions form the industry’s most comprehensive portfolio of high-quality, precision-engineered products. With renown brands such as Gruvlok, Merit, FlexHead, FPPI, NAP, SprinkFLEX, Sharpe etc.
Borusan Mannesmann
Borusan Mannesmann is among the well-established institutions of the Turkish industry, with its history dating back to 1958, quality products, and a reputation as a reliable brand. The company, which has had a global vision since the first day it was founded, is Türkiye’s leader in the steel-pipe sector and one of the leading manufacturers in Europe and the world, with its 8 facilities on 3 continents and high sales volume. The company carries out its production activities at its plants in Gemlik, Halkal?, and Bursa in Türkiye, Vobarno in Italy, Houston Baytown in the US, and Ploie?ti in Romania. Having ranked in the top 100 of the list of Türkiye’s largest industrial enterprises for 50 years, Borusan Mannesmann is manufacturing pipes and building Türkiye’s future with its thousands of products, reliable service, quality, and pioneering achievements in Türkiye and the world.
It offers a sustainable society and world via its governance policies, a developed country, and a secure future via its large-scale investments.
Clarke Fire
Clarke Fire are the global supplier of emergency standby diesel fire pump engines. Established in 1964, we have nearly 60 years’ experience in developing diesel engines to meet demanding fire pump requirements and providing end users with piece of mind that their sprinkler systems source of power is guaranteed in times of emergency. Clarke partners with renowned engine OEM’s John Deere, CAT, Kohler and Doosan, which allows us to support sprinkler installations from basic commercial sites, to high value energy assets. We specialise in NFPA 20, FM Approved, UL Listed & LPCB Approved applications, we also supply European country code compliant engines.
CNP NM FIRE FIGHTING SYSTEM CO
Our mission is to produce the highest standard products with the advanced technology to “Protect life, love and history” for the big world.
CST Industries
CST Industries (UK) Ltd specialises in the design, manufacture and construction of LPCB & FM Cylindrical galvanized steel bolted storage tanks. All tanks come with a CE marked approval, which are primarily used for storing water in the fire sprinkler, potable water and irrigation markets.
Dafo Fomtec AB
Dafo Fomtec AB is a privately owned company with head office in Stockholm Sweden and manufacturing in Helsingborg Sweden.
Regardless of your application, Dafo Fomtec AB has the right product. We can provide the right foam for your existing facility or a full-scale solution combining foam and hardware. We supply products for aviation, industry, marine, fire brigades, etc.
Fomtec offers a large range of both synthetic-based and protein-based fluorine free foam concentrates. Our range of Synthetic Fluorine Free Foams (SFFF) are marketed under the brand Enviro by Fomtec.
Visit us at FSI 2023 to get the opportunity to discuss fire safety solution with our competent team.
Dr. Richard Sthamer GmbH & Co. KG
Dr.STHAMER, founded in 1886 in Hamburg/Germany, is specialised in producing firefighting foam agents since the 1920s.
Intense research and development in order to provide solutions for the general need to improve the performance of fixed foam systems, taking into account environmentally responsible concepts, made Dr.STHAMER to the technology leader in this industry.
One of the latest innovations is the vaPUREx®-PLY – a fluorine free foam as a one-by-one replacement – for plastic fire risks. Furthermore, Dr.STHAMER invented a Sprinkler-Adapter in cooperation with Eurosprinkler from Switzerland that facilitates the change to fluorine free foams in sprinkler or deluge systems which protect liquid fuels.
Duyar
Duyar was founded in Istanbul in 1965. Today, Duyar is one of Turkey’s leading HVAC, plumbing, and fire protection systems manufacturing companies and Duyar products are being used in more than 85 countries. Duyar is the only European member of the International Fire Sprinkler Association. Duyar’s corporate philosophy is to bring to the market new and innovative product designs with special emphasis on quality, safety, ease of operation, simple in-line maintenance, and long service life. All this, combined with the use of high-quality materials and advanced manufacturing technology in all manufacturing stages, ensures the highest possible quality at a competitive price.
Engineered Corrosion Solutions BV
Engineered Corrosion Solutions BV is an engineering firm specializing in helping clients understand and manage risk associated with corrosion of fire sprinkler systems. Since 2003 ECS has pioneered the research of corrosion in fire sprinkler systems, leading ECS to develop and introduce patented corrosion control equipment and methods including nitrogen inerting. Corrosion in fire sprinkler systems leads to water damage, plugging problems, reduced hydraulic performance, and reduced service life. The risks associated with these issues include life safety risk, property risk, and business continuity risk. It is ECS’ commitment to define and understand the root causes of corrosion in fire sprinkler systems in order to provide products and services that significantly reduce risk for end users.
Engineered Fire Piping
FIRE PIPING is the EU leader for prefab piping for:
- Quality & Environment: VdS and FM APPOVED and ISO 9001 and 14001.
- Production capacity: 6 ROBOTS and upgraded POWDER COATING LINE for over 3 MILLION sockets/year
- Cost effective, Fast Delivery & Engineering cutsheets and plan piping support.
We add value to top EU contractors with main benefits:
- Cost-effective (prefab+Installation+Fast delivery) and non-competition activities.
- Experience with skilled team engineering-manufacturing-logistics for fast deliveries on jobsite.
- Technical support for prefab with friendly own software.
EuroSprinkler AG
EuroSprinkler AG from Switzerland is one of Europe’s leading sprinkler manufacturers.
We provide sprinklers, dry sprinklers and low expansion foam sprinklers as well as the necessary accessories. Test devices for flow switches are also available.
EuroSprinkler can supply the whole range of VdS approved and CE marked sprinklertypes with escutcheons, guards, shields and installation tools. High qualitiy, individual paint schemes, special technical solutions and a fast delivery are our daily business.
Fire Protection Association
The FPA is one of the leading experts for sprinkler system inspections, head testing, pipework testing and water mist testing. We wrote the LPC Rules for Automatic Sprinklers and have a purpose-built, dedicated laboratory where our specially trained engineers conduct our sprinkler system tests. We provide detailed and comprehensive reporting, written by our team of experts to help ensure that your system works as it should. All sprinkler heads are tested in our sprinkler laboratory where we provide guidance complying with the LPC Rules for Automatic Sprinklers 2015 incorporating BS EN 12845, Clause 20, Annex K and LPC Technical Bulletin TB203.
FM Approvals
FM Approvals offers international certification services for products related to property risk mitigation. Recognized and respected across the globe, FM Approvals certification assures that a product or service has been objectively tested and conforms to rigorous property loss prevention standards. The FM APPROVED mark, backed by scientific research and testing helps set these products apart from others on the market.
We test and Approve property loss prevention products with one overarching goal in mind: to verify that they perform whenever they are called upon to do so.
Products with the FM APPROVED certification mark adhere to the highest standards in quality, technical integrity and performance.
FOGTEC Brandschutz GmbH
FOGTEC Brandschutz GmbH, headquartered in Germany, is one of the world’s leading suppliers of water mist fire protection systems with 25 years of experience. The company has worldwide more than 60 licensed partners who service customers. The FOGTEC portfolio includes full service solutions, consultancy work, the supply of components and complete systems up to installation and maintenance of water mist fire protection systems. FOGTEC systems discharge pure water at approximately 100 bars through nozzles to create a fine water mist. FOGTEC systems are protecting thousands of fire risks in buildings and different industries including battery applications all over the globe.
Holzhauer-Pumpen GmbH
Fire safety is our mission.
We protect people, buildings, assets and property.
Founded in 1969, we have grown to become a globally recognized supplier of stationary fire protection solutions for a wide range of applications. For our customers all over the world, we develop complex, high-quality fire extinguishing systems to meet their exact requirements. Through constant innovations and new developments, we make a significant contribution to the further development of fire protection. We are proud of our work and our technological leadership in many areas.
HRS Systems
HRS Systems’ suite of hydraulic analysis solutions has been leading the fire protection industry in accuracy, reliability, and simplicity for over 45 years. HASS tools allow for faster designs, unmatched calculation accuracy, significant cost reduction, and easy-to-understand report prep for any water-based or CO2 suppression system. Being family-owned and operated since 1976, our top priority is to welcome our customers into the HRS family by providing the highest level of service and support. HRS Systems is an original pioneer in hydraulic analysis technology, and we’re still working to push the envelope today.
International Water Mist Association
The International Water Mist Association (IWMA) supports the development, research and applications engineering of generic water mist systems. Members of IWMA are, amongst others, manufacturers, distributors, insurance companies and scientific institutes from all over the world. IWMA holds an annual two-day conference and offers seminars / webinars regularly to promote the technology.IWMA representatives are involved in a number of expert and working groups as well as technical committees such as the CEN TC 191 / WG 10, NFPA 750 and 25, VdS 3188, IMO (International Maritime Organization) and EMSA (European Maritime Safety Agency at the European Commission).
JOB GmbH
JOB Thermo Bulbs, founded in 1971, is the world leader in research and production of heat sensitive Glass Bulbs, Thermo Bulb Links and Miniature Fire Extinguishers for life safety applications. Due to their high quality and reliability nearly 2,000 Mio JOB Thermo Bulbs have been installed by all major sprinkler manufactures worldwide. More than 50 years of continuous innovation and the implementation of innovative technologies guarantee the highest possible standard for life safety products. JOB uses its self drawn glass tubes and can offer a huge flexibility for different bulb specifications towards customer’s demand.
Johnson Controls
With over 130 years in the fire sprinkler industry, Johnson Controls is uniquely qualified to deliver cost-effective solutions that can be customised to a building configuration of fire protection applications. Through ongoing, world-class research and development, we’re continually expanding our capabilities. Our commitment to excellence is back by an industry-leading 10-year Limited Warranty and world-class technical support.
Kiwa Fire Safety & Security
Kiwa Fire Safety & Security is an international testing, inspection and certification (TIC) player that can offer you a wide range of products, services and training in the field of fire safety. We test products such as smoke detectors, sprinklers and foam agents. We certify companies based on international schemes and inspect fire protection systems for local and international markets. Through our TIC portfolio, we are constantly aware of the latest developments. We help you demonstrate the quality of your products and services and establish the effectiveness of your fire protection in an impartial and expert manner. We create trust!
Marioff Corporation Oy
Marioff is a leading developer of high-pressure water mist fire protection technology and supplies Marioff HI-FOG® solutions and BluEdgeTM lifecycle services worldwide. The company’s innovative HI-FOG water mist fire protection system controls and suppresses fire using significantly less water than conventional sprinkler systems, reducing water damage, clean up time and operational downtime. Marioff is a part of Carrier, the leading global provider of healthy, safe, sustainable and intelligent building and cold chain solutions.
MECON
MECON GmbH is a German based company specializing in the manufacture of LPCB, FM and VdS approved fire pump flowmeters, hose and hydrant testers and sensor products for the fire sprinkler business. Founded in 2002, MECON GmbH is dedicated to providing high-quality, reliable and cost effective solutions for its customers. With its wide range of products, MECON GmbH is committed to ensuring the safety and reliability of fire sprinkler systems worldwide.
nVent CADDY Seismic Solutions
At nVent, we believe that safer system ensure a more secure world. We connect and protect our customers with inventive electrical and fastening solutions. nVent CADDY Seismic Solutions protect people, property and equipment during and after a seismic event by ensuring business continuity and continued operation of critical infrastructure and services.
From design to construction to inspection, the nVent CADDY Seismic Solutions team makes seismic simple by walking through the full process for Fire Protection, Mechanical, Electrical and Plumbing applications, providing technical support and codes compliant, third-parties approved products for rigid and cable bracing solutions.
Pentair: specialist in firefighting pumps and pump sets
Pentair in Winterswijk (The Netherlands) specializes in designing, producing, and maintaining standard and tailor-made pumps and pump systems. We offer our customers a complete solution from design to installation and maintenance. Over the past few decades, we have become a market leader in firefighting pumps and complete pump rooms for industrial, oil & gas, and maritime applications. Our firefighting pumps and pump sets are available by various international standards. Also, we have a dedicated production line for standard pump sets for sprinkler installations in logistic and utility projects. Customers benefit from a dedicated sales team, short delivery times, and excellent after-sales service.
Piping Logistics
Piping Logistics produces and supplies piping components for FIRE sprinkler & HVAC installations. Our Profit brand, already well known in the fire protection industry since 15 years, consists of a wide range of grooved fittings, couplings and accessories combined with a growing range of valves and hoses. With our privileged locations in Europe, where we keep one of the largest stocks, we strive for fast deliveries directly to your construction site. Our own R&D engineering department focuses on design and development of our own Profit branded products in order to make fire protection and life easier, but above all safer.
Potter Electric Signal
Established in 1898, Potter Electric Signal Company produces a wide array of products proudly assembled in the USA, including fire sprinkler monitoring systems, nitrogen generators, corrosion monitoring/testing, electronic fire systems, vault and safe security systems, and boiler/chiller and industrial control products. At Potter, not only do we supply our customers with products that provide real world solutions for their unique needs, we strive to provide them unequaled service and technical support. Every employee at Potter is committed to provide the very best product and service available for the protection of life and property. Potter is THE Symbol of Protection.
QC supply B.V.
QC supply B.V. is your dedicated supply partner for sprinkler and HVAC piping projects. QC Supply is the official European distributor for the Quikcoup grooved pipes connection system. We offer next to Quikcoup an extended line of valves, flexible sprinkler hoses, +GF+ malleable fittings, fasteners and many more products. QC Supply holds a large stock in order to fulfill the fast delivery requirements that the sprinkler and HVAC industry demands today.
Rapidrop
Rapidrop are a UK based manufacturer of fire detection and suppression equipment. Offering international sales and distribution which serves the needs of the fire service industry, Rapidrop offers clients a variety of accredited and competitive solutions for projects around the world. You will find their projects in locations across the United Kingdom, Europe, UAE and more. Rapidrop includes dedicated and skilled supply and engineering teams who pride themselves on providing extensive experience and knowledge to the products they provide.
Regalplus GmbH
Regalplus GmbH developed the VdS-approved, award-winning SprinklerSafe-Sicherheitssystem® brackets which prevent fire sprinkler heads from being damaged while loading and unloading in storage racking. Stored goods are thus efficiently protected against unintentional spill of extinguishing water. SprinklerSafe-SicherheitsSystem® is currently VdS-approved for 150 fire sprinklers made by EuroSprinkler, Minimax, Reliable and Tyco. The Regalplus team is continuously working on the development of product compatibility to achieve maximum safety benefits for their clients. Regalplus develops & delivers tailor-made, innovative risk solutions.
SprinklerSafe-Sicherheitssystem® has been installed at: Ceratizit, Dachser Logistics, Nordfrost, Porsche, Südpack… SPRINKLERSAFE-SICHERHEITSSYSTEM® THE VDS-APPROVED SPRINKLER SAFETY BRACKETS THAT TRULY DESERVE THEIR NAME.
Reliable Fire Sprinkler GmbH
Reliable Automatic Sprinkler Co., Inc. is a family run, international company that is one of the world’s largest producers of automatic fire sprinklers and sprinkler system control equipment. The company was founded in 1920 and is continuing to expand and grow. Reliable now have a 467,000 square foot facility in South Carolina and sales offices located around the world. Reliable’s mission is to serve as a fire protection leader by (i) manufacturing the highest quality sprinklers and valves (ii) producing and distributing a complete line of system components (iii) providing innovative solutions (iv) delivering the highest level of customer service and (v) teaming with customers as valuable strategic partners; while upholding the Fee Family ownership-management commitment of supporting the fire protection industry, associations and Reliable family of employees since 1920. Reliable produces a vast range of sprinklers featuring solder types and frangible bulbs.
They also produce a broad range of valves including alarm, dry, deluge, preaction, and check valve that control water flow to sprinkler systems and actuate alarm signalling. Reliable products are listed and approved by various fire protection product approval laboratories and organizations. Reliable is also pursuing a Green Policy and is committed to protecting our environment by developing products that use recycled materials that reduce the use of natural resources.
Société Française de Réservoirs
Société Française de Reservoirs brings you the best solution for the development of your projects in fire protection, potable water, industrial and untreated water, … The company was founded in 1996 and is headquartered in south-west of France: we work all around Europe and worldwide. Bolted cylindrical steel tanks. Internal sealing with reinforced PVC liner 800g/mÇ. Diameter from 2.34m to 17.94m and height from 1.50m to 19.00m. Galvanized steel sheets of our tanks can be powder coated or treated to suit aggressive environments. Volumes up to over 5000m3. We design our tanks according to climatic elements such as wind, snow and seismicity, and we are FM Global Approved. Applicable Standards: APSAD, NFEN, NFPA, FM Global, VDS. From our industrial site in Vielle Saint Girons, our teams support you anywhere in the world. A 100% French manufacturing guarantee of quality.
SPP Pumps
SPP Pumps is the world’s leading specialist manufacturer of quality fire protection pump packages. Our unrivalled experience in design and manufacture together with advanced testing, accreditation and lifetime global support for all fire pumps and fire pump equipment ensures the utmost in fire pump reliability. SPP Pumps Fire Pumps are designed specifically for the very particular needs of fire protection and are approved by major fire protection bodies around the world. As the first company to achieve fire pump approval and listing by the Loss Prevention Certification Board (LPCB), SPP Pumps have more approved and fire pump listed equipment than any other manufacturer.
SprinklerView Inc.
SprinklerView is groundbreaking. They keep improving the monitoring of fire sprinkler systems by using intelligent edge technology and common sense in creating remote 24/7 automated and digitalized sprinklerview from anywhere, anytime, to secure, that the vital sprinkler pump parts will function as expected in the event of an incident.
System VIROTEC®
System VIROTEC® is a well arranged product array of pipe joint elements for use in pipeline construction, particularly suitable for the manufacture of sprinkler systems (automatic, stationary fire extinguishing equipment).
These products are efficient and innovative and feature:
- easy and quick assembly
- high degree of functional safety
- comprehensive range
- attractive design and high-quality workmanship
Our component parts are tested and acknowledged at VdS Schadenverhütung in Cologne and FM (Factory Mutual) in USA. All products are developed, manufactured and distributed in conformance with a recognized QA system as per DIN EN ISO 9001. Some products are protected by international patents and/or patented designs. Our qualified and efficient team offers the best possible consultation to customers and ensures quick and smooth processing of the sales orders.
With our extensive range of pipes and pre-fabricated pipes, we are a one stop shop for all products relating to your pipeline system all over the world.
TESLA
Tesla is committed to helping fire departments and first responders safely handle emergency situations involving all Tesla products.
Tornatech Europe SA
Based in Belgium since 2011, Tornatech Europe SA is the European subsidiary of Tornatech Inc. headquartered in Montreal, Canada. We specialize in the conception and manufacturing of fire pump controllers in accordance with the NFPA 20 standard, listed by UL and approved by FM as well as other European standards such as EN12845, A2P & LPCB.
Our products have proven to be reliable property loss equipment in many mechanical rooms worldwide. At Tornatech, we are committed to delivering innovative products offering the best technical solution, superior quality, and supported by outstanding service.
TUBAO s.a.s
Customized design, innovative engineering, own production, located in Normandy, France. We produce corrugated galvanized steel water reservoirs for underground installation. Our cilindrical tanks are produced in diameter up to 3,00m, length up to 21,00m in one piece and they can be assembled into infinite volumes. In the underground they are protected from aggressive climatic elements. The resistance of the Tubao tubes is calculated to ensure they withstand roadway loads without concrete distribution slab. They withstand perfectly soil and water forces. Our reservoirs are light, flexible, easy to handle and very simple and fast to install. Certified for extinguishing water supply.
Tubasys
Tubasys is a FM and VdS approved company for prefabricated pipes with production capacity close to 2 million outlets/year in our 2 production plants.
Automated and robotized production processes and strict quality controls have earned the trust from our clients all over the world.
We offer a wide of pipe diameters and standards, grooved and threaded outlets, adjusting to the needed pipe length up to 12 m.
In order to develop the design and implementation of customized projects, Tubasys’s list of products includes prefabricated piping systems, including bending and curved pipes, prefabricated pump-rooms, grooved accessories, flexible hoses and valves.
Gebr. Van Walraven
We have been a wholesaler of infrastructure and installation products since 1968. Our range is large and varied. Our products are suitable for residential and commercial construction as well for civil engineering and industry. With more than 60,000 products, 40,000 M2 of area and 13 locations, we ensure optimal and various stock. Quality is our priority. All our products are carefully selected for you as customer. We now carry more than 500 brands.
VANSTRAELEN SPRINKLER PIPING
VANSTRAELEN SPRINKLER PIPING is a Belgian company specialized in the production of prefabricated pipes for automatic sprinkler installations. Founded in 1987, Vanstraelen Sprinkler Piping has an extensive experience as a partner of the certified installers. Our 10.000 m² production facility includes 5 automated welding robots with an annual capacity of 1.000.000 welded outlets.In addition to prefabricated pipes, we are also supplier of complementary products such as grooved fittings, threaded fittings, flexible hoses, fixations, hose reels, …
VdS Schadenverhütung GmbH
VdS is one of the world’s most renowned institutions for corporate safety and security. 500 experts offer a unique range of services for fire protection, security, cyber-security and natural hazard prevention.Services include risk assessments, testing and certification, inspections, information systems for natural hazards and an extensive training program. In addition, the independent organisation sets international safety and security standards with the publication of a comprehensive set of Guidelines.
The optimal protection of our partners is based on a worldwide unique protection concept whose reliability builds on more than 110 years of VdS-experience, combining all core aspects of loss prevention. Decision-makers around the world rely on VdS-approved reliability and certainty.
Victaulic
Victaulic® innovation began in 1919 with the first grooved-end mechanical pipe joining technology. Today, Victaulic technology includes a complete offering of certified sprinklers, couplings, fittings, valves, flexible hoses, accessories and tools to meet the needs of any fire protection application. Avoid the risk of leaking threaded pipes and save on labour with our unique, one bolt coupling and say goodbye to incorrect sprinkler installation with our revolutionizing grooved sprinkler range. All our products are designed to minimize installation time and to mitigate labour risk and incorrect installations without compromising on quality. Discover more on Victaulic.com.
Viking
Viking is renowned for the development, manufacturing, sales and distribution of excellent fire protection technologies and has been a dependable partner in fire protection for many decades.The broad product portfolio encompasses innovative and proven system components for water, foam and gas extinguishing systems as well as fire detection systems and is a reflection of Viking’s unwavering focus on providing customers with the finest products and highest level of support.
WB Firepacks
WB Firepacks is an international manufacturer, installer and maintenance partner of pump installations for extinguishing systems. Together we have been making society more fire-safe for over 50 years. We do this from our head office in the Netherlands in close collaboration with consultants, installers and (end) users of sprinkler, mist and foam solutions. All our installations meet – at a minimum – the strictest (inter)national standards. We guarantee 100% reliability. We take care of our customers in the entire process: selection and purchase, installation and commissioning, inspect, certify and maintain the installation. That also means that we always deliver custom work; every environment requires a specific, own extinguishing method. By sharing our knowledge and experience, we ensure that safety is never compromised.